PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.011G041200.1
Common NamePHAVU_011G041200g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family SRS
Protein Properties Length: 212aa    MW: 23763.7 Da    PI: 8.4102
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.011G041200.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF70294.62.1e-291475465
              DUF702  4 gtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaa 65
                        ++++C++CGnqakkdCa++RCRtCCk++gf+C+th++stW+p+++rr++ +++  +++ ++ 
  Phvul.011G041200.1 14 KGSKCEECGNQAKKDCAYSRCRTCCKNKGFKCQTHIRSTWIPVDRRRHKVEHQPLTTNLQQG 75
                        6789********************************************98887766554433 PP

2DUF70270.74.5e-228514296154
              DUF702  96 skkeletsslPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGlee 154
                         + ++l   ++P+  ss+a f+cv+v+s+dd  +e+aYqt+v+igGhvf+G+LydqG+e+
  Phvul.011G041200.1  85 PYSSL-EFKFPAVTSSMASFSCVQVRSMDDTVNETAYQTSVNIGGHVFSGFLYDQGPEQ 142
                         22233.334************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051421.6E-4215141IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016231.4E-241759IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016244.7E-1992140IPR006511Lateral Root Primordium type 1, C-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 212 aa     Download sequence    Send to blast
MSTMQEQGLE TVVKGSKCEE CGNQAKKDCA YSRCRTCCKN KGFKCQTHIR STWIPVDRRR  60
HKVEHQPLTT NLQQGDIPKR HKHNPYSSLE FKFPAVTSSM ASFSCVQVRS MDDTVNETAY  120
QTSVNIGGHV FSGFLYDQGP EQSFNAKGDN PFDQQHDLNL RSVSLHTRDG ASATMPPLSL  180
TASQEPFFIP HHSFPLASFR PDLTYLSHPK P*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007131783.11e-160hypothetical protein PHAVU_011G041200g
SwissprotQ9SJT82e-44SRS3_ARATH; Protein SHI RELATED SEQUENCE 3
TrEMBLV7ADZ41e-160V7ADZ4_PHAVU; Uncharacterized protein
STRINGGLYMA11G12101.11e-111(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF99692541
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G21400.11e-45SHI-related sequence3